Protein Info for CSW01_04385 in Vibrio cholerae E7946 ATCC 55056

Annotation: RnfH family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 PF03658: Ub-RnfH" amino acids 8 to 90 (83 residues), 121 bits, see alignment E=1.1e-39

Best Hits

Swiss-Prot: 100% identical to Y850_VIBCH: UPF0125 protein VC_0850 (VC_0850) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K09801, hypothetical protein (inferred from 100% identity to vch:VC0850)

Predicted SEED Role

"UPF0125 protein yfjF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (103 amino acids)

>CSW01_04385 RnfH family protein (Vibrio cholerae E7946 ATCC 55056)
MMMSSEMIHVEVVYALPHEQRVLKLVVEQSATVEEIIRTSGILQMYPEIDLTVNKVGIFS
RNVKLDARVRDKDRIEIYRPLLADPKEIRRKRAEQAKAAANQS