Protein Info for CSW01_04305 in Vibrio cholerae E7946 ATCC 55056

Annotation: toxin coregulated pilus biosynthesis protein E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 112 to 131 (20 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details PF00482: T2SSF" amino acids 15 to 135 (121 residues), 49.1 bits, see alignment E=2.8e-17 amino acids 212 to 330 (119 residues), 46.9 bits, see alignment E=1.4e-16

Best Hits

Swiss-Prot: 100% identical to TCPE_VIBCH: Toxin coregulated pilus biosynthesis protein E (tcpE) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K10934, toxin co-regulated pilus biosynthesis protein E (inferred from 100% identity to vco:VC0395_A0361)

Predicted SEED Role

"Toxin co-regulated pilus biosynthesis protein E, anchors TcpT to membrane" in subsystem Toxin co-regulated pilus or Vibrio pathogenicity island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>CSW01_04305 toxin coregulated pilus biosynthesis protein E (Vibrio cholerae E7946 ATCC 55056)
MKIISKKYRLELYSMLVDLLNDNIPLYDALNKIQNEGVGIYDKNFIKSIELIKDRMKSNS
SLTDALTGLIPDKEVLMINVAENSGKISSGIAAIRKNIIDADEIKSKAISSMITPSVMLI
VTMVVIAGYSVKVFPTFESVLPVSRWPGVTQALYNLGFSLYEGLWIKVLIFVAIFITILV
FMSKNITGNFRDGFLDKLPPFNFVKHIAATEFLANMSMLLDSRVPFKEGLDIVDHKTTRW
LSSHLQRMKANMQEGLDYKQALDTNLLDKKMLLTMAVYSELPNFSDVMQKLAIEANINLH
KKIATLAGVMKNISLITLALSVIWIFGAIFSLVDKLSSSL