Protein Info for CSW01_04265 in Vibrio cholerae E7946 ATCC 55056

Annotation: toxin coregulated pilin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 27 to 49 (23 residues), see Phobius details PF07963: N_methyl" amino acids 22 to 45 (24 residues), 23 bits, see alignment (E = 4.5e-09) TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 23 to 45 (23 residues), 21.1 bits, see alignment (E = 1e-08) PF05946: TcpA" amino acids 97 to 222 (126 residues), 228.7 bits, see alignment E=1.9e-72

Best Hits

Swiss-Prot: 100% identical to TCPA_VIBCH: Toxin coregulated pilin (tcpA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K10930, toxin co-regulated pilin (inferred from 100% identity to vcm:VCM66_0785)

Predicted SEED Role

"Toxin co-regulated pilin A" in subsystem Toxin co-regulated pilus or Vibrio pathogenicity island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>CSW01_04265 toxin coregulated pilin (Vibrio cholerae E7946 ATCC 55056)
MQLLKQLFKKKFVKEEHDKKTGQEGMTLLEVIIVLGIMGVVSAGVVTLAQRAIDSQNMTK
AAQNLNSVQIAMTQTYRSLGNYPATANANAATQLANGLVSLGKVSADEAKNPFTGTAMGI
FSFPRNSAANKAFAITVGGLTQAQCKTLVTSVGDMFPFINVKEGAFAAVADLGDFETSVA
DAATGAGVIKSIAPGSANLNLTNITHVEKLCTGTAPFTVAFGNS