Protein Info for CSW01_04215 in Vibrio cholerae E7946 ATCC 55056

Annotation: IS481 family transposase ISVch1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF13518: HTH_28" amino acids 7 to 58 (52 residues), 38.6 bits, see alignment 2.6e-13 PF13551: HTH_29" amino acids 10 to 71 (62 residues), 34.2 bits, see alignment E=6.7e-12 PF13565: HTH_32" amino acids 34 to 108 (75 residues), 50.8 bits, see alignment E=6.4e-17 PF00665: rve" amino acids 132 to 224 (93 residues), 64.5 bits, see alignment E=2.8e-21 PF13683: rve_3" amino acids 212 to 279 (68 residues), 64.3 bits, see alignment E=2.2e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_003511)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>CSW01_04215 IS481 family transposase ISVch1 (Vibrio cholerae E7946 ATCC 55056)
MDREIQQRLQWVKMYEECGDAGLVCRRCGISRPTLRKWAKRYKQCGIAGLESQSRRPHSS
PDTKLTDELRALILTMRDKRNLGARRLQTELIRLHKIHLSTATLHKVLSEASVKPIVTYR
RKKDFQRYERPIPGDRVQMDTCKIAPGIYQYTAIDDCSRYRVLRCYSRRTAANTVDFIDC
VVEEMPFPIQRIQTDRGREFFAEKVQKQLMIYGIKFRPNKPGSPHLNGKVERSQKTDKSE
FYPTIDVSVGLQELDLLLAEWQHYYNWERPHSSLNGLTPIDRITEISDQTPLSEEVSQNY
QIKKERFQEQNYKLDLQLRKLKPSL