Protein Info for CSW01_04135 in Vibrio cholerae E7946 ATCC 55056

Annotation: apo-citrate lyase phosphoribosyl-dephospho-CoA transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 TIGR03124: holo-ACP synthase CitX" amino acids 9 to 174 (166 residues), 213.7 bits, see alignment E=7.2e-68 PF03802: CitX" amino acids 9 to 173 (165 residues), 190.9 bits, see alignment E=7.3e-61

Best Hits

Swiss-Prot: 100% identical to CITX_VIBCM: Probable apo-citrate lyase phosphoribosyl-dephospho-CoA transferase (citX) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K05964, holo-ACP synthase [EC: 2.7.7.61] (inferred from 99% identity to vco:VC0395_A0327)

MetaCyc: 43% identical to apo-citrate lyase phosphoribosyl-dephospho-CoA transferase (Escherichia coli K-12 substr. MG1655)
Citrate lyase holo-[acyl-carrier-protein] synthase. [EC: 2.7.7.61]

Predicted SEED Role

"Apo-citrate lyase phosphoribosyl-dephospho-CoA transferase (EC 2.7.7.61)" (EC 2.7.7.61)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>CSW01_04135 apo-citrate lyase phosphoribosyl-dephospho-CoA transferase (Vibrio cholerae E7946 ATCC 55056)
MSHHPDLSVSLDQLLLRKEVRVRQQGEWLKRHSLPLVSFTVNMPGAVKLNAASQTVMDAG
MRAIQELCQKTGWRQVACQLLVEKTGPEAFVVIQAPSASMLKKAMMKIEREHPLGRLMDL
DVIDVDGHIISRQGAQLPRRRCLLCERDAVICARSRRHSVEALLAKIEEMTHDYSCCA