Protein Info for CSW01_04115 in Vibrio cholerae E7946 ATCC 55056

Annotation: [citrate (pro-3S)-lyase] ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR00124: [citrate (pro-3S)-lyase] ligase" amino acids 12 to 342 (331 residues), 457.3 bits, see alignment E=2.9e-141 PF00583: Acetyltransf_1" amino acids 28 to 115 (88 residues), 28.8 bits, see alignment E=2.6e-10 PF13508: Acetyltransf_7" amino acids 42 to 115 (74 residues), 29.4 bits, see alignment E=1.7e-10 PF08218: Citrate_ly_lig" amino acids 152 to 338 (187 residues), 287.6 bits, see alignment E=7.5e-90 TIGR00125: cytidyltransferase-like domain" amino acids 152 to 207 (56 residues), 43.1 bits, see alignment E=3.7e-15 PF01467: CTP_transf_like" amino acids 160 to 238 (79 residues), 22.7 bits, see alignment E=2e-08

Best Hits

Swiss-Prot: 51% identical to CITC_ECOLI: [Citrate [pro-3S]-lyase] ligase (citC) from Escherichia coli (strain K12)

KEGG orthology group: K01910, [citrate (pro-3S)-lyase] ligase [EC: 6.2.1.22] (inferred from 100% identity to vcm:VCM66_0754)

MetaCyc: 52% identical to [citrate [pro-3S]-lyase] ligase (Klebsiella pneumoniae)
[Citrate (pro-3S)-lyase] ligase. [EC: 6.2.1.22]

Predicted SEED Role

"[Citrate [pro-3S]-lyase] ligase (EC 6.2.1.22)" (EC 6.2.1.22)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>CSW01_04115 [citrate (pro-3S)-lyase] ligase (Vibrio cholerae E7946 ATCC 55056)
MRKPTMVDIYTFSRVSTKNRTKLLQIKEFLCQHQLTVDDDVEHFVVAYGTNQIIACGGIA
GHVLKSIAVSPALQGTGFALKLMTELTNFAYEMGRFSLFLFTKPANIDLFRQCGFFLVDK
VEPHIALLENSPNRLSVYCKQLQLLKMSGRKIGSIVMNANPFTLGHQYLIEQACEQCDWV
HLFVVKAENKDFSYADRMAMIKAGSKHLLNLTIHSGSDYIISRATFPSYFIKDQQVVNQS
HTALDLSIFRHSIAPALGITHRFVGSEPICTVTRHYNQAMRRWLEEAHDASAPIQVVEIE
RSQQASQPISASRVRYLLKQFGFAAIADLVPKTTYSYLCQHYAEHSLQTAPQLLAV