Protein Info for CSW01_04090 in Vibrio cholerae E7946 ATCC 55056

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details PF17203: sCache_3_2" amino acids 49 to 178 (130 residues), 69.9 bits, see alignment E=4.9e-23 PF14689: SPOB_a" amino acids 342 to 389 (48 residues), 28.7 bits, see alignment 1.6e-10 PF02518: HATPase_c" amino acids 441 to 548 (108 residues), 70.1 bits, see alignment E=4.2e-23 PF14501: HATPase_c_5" amino acids 443 to 536 (94 residues), 33.8 bits, see alignment E=5.5e-12

Best Hits

Swiss-Prot: 42% identical to DPIB_ECOLI: Sensor histidine kinase DpiB (dpiB) from Escherichia coli (strain K12)

KEGG orthology group: K07700, two-component system, CitB family, cit operon sensor histidine kinase CitA [EC: 2.7.13.3] (inferred from 100% identity to vch:VC0791)

MetaCyc: 42% identical to sensor histidine kinase DpiB (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Sensor kinase CitA, DpiB (EC 2.7.3.-)" in subsystem Orphan regulatory proteins (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (565 amino acids)

>CSW01_04090 sensor histidine kinase (Vibrio cholerae E7946 ATCC 55056)
MKISLAQFLHTKVCQTLSFQQRVGALLVAMVVIQLSLVAGFFHQTLSETLQDQISTKALI
QAREIATDPNLIVLIQQNRLAEVQAKIDRLQRISDANFIVIGDANGIRIAHPDEQKIGLP
MQGGDSRRALKEGEYYTSTQKGSLGWAIRGKAAIVAPSGEILGVVSVGYLLDNISSWLRV
YSYPVIFTVLLLMLLSALGAWIFTRHIKQQMFNMEPEEIAMNLNLQQSILQSVYEGIVAI
SLKGEILSVNAKALNILGIAHQPTHLIGRNVQEFITPTCFFMGASPFGKLAQQNRVSQQD
ELISCNGETLVANRVPINSGQQQIGWVVSFRRRNDFNTLTSQLTQIRQHNDNLRVMSHEF
ANRLSTIGGLIQIGAYDEAVKTIRRETAEQQQLIDFIAQTFHPKVIAGLLLGKYSRAKEL
GLCLEFDPLSHLHQEPQCMTSDELAAVLGNLLDNAFEATLKNPHSNKTISLLLTDNGAEL
VIEVADNGIGISADIAQTLFLKGVSSKNQEGHGIGLYLVHQFVTQAHGSILIDSAEPQGT
IFSIFIPNRPKTLAAENLPALAERA