Protein Info for CSW01_04055 in Vibrio cholerae E7946 ATCC 55056

Annotation: alkyl/aryl-sulfatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 660 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00753: Lactamase_B" amino acids 127 to 350 (224 residues), 63.2 bits, see alignment E=8.3e-21 PF12706: Lactamase_B_2" amino acids 140 to 215 (76 residues), 27.9 bits, see alignment E=4.3e-10 PF14863: Alkyl_sulf_dimr" amino acids 387 to 525 (139 residues), 183.1 bits, see alignment E=8.9e-58 PF14864: Alkyl_sulf_C" amino acids 534 to 657 (124 residues), 141.6 bits, see alignment E=3.8e-45 PF02036: SCP2" amino acids 559 to 646 (88 residues), 37.2 bits, see alignment E=7.7e-13

Best Hits

Swiss-Prot: 45% identical to BDS1_YEAST: Alkyl/aryl-sulfatase BDS1 (BDS1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: None (inferred from 100% identity to vch:VC0783)

MetaCyc: 48% identical to linear primary-alkylsulfatase (Escherichia coli K-12 substr. MG1655)
RXN-15761 [EC: 3.1.6.21]

Predicted SEED Role

"Alkyl sulfatase (EC 3.1.6.-)" (EC 3.1.6.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.6.- or 3.1.6.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (660 amino acids)

>CSW01_04055 alkyl/aryl-sulfatase (Vibrio cholerae E7946 ATCC 55056)
MKTVFKPTLLAVLVAASAPVLAHSLIADTKAPSPTTKAFAAEQRNTLPFADQEDFKLVEK
GLIAQQKDLEIKDANGKVVWELGNYRFLLDGLDYDSIHPSLQRQAQLNMHHGLYKVTDRI
YQVRGYDLANITFVKGDTGWIVFDPLTVPATAKAALDFVNQELGERPVKAVVYSHAHADH
FGGVKGIVSQEQVDRGEVPIIAPKGFLNHAVAENVLAGNAMSRRTTYQYGNVLPKGATGQ
VDAAIGKNVAQGEVSLIAPTKVISEQTETVVIDGVTMEFQNTPGTESPAEMNTYFPQFKA
LWMAENTVGGLHNVYTLRGAEVRDAKAWSKYINESIHMYAKEADVMFASHTWPRWGNDNI
NHFLRKQRDMYGYIHDQALRLANHGVTINEIQDEFHVPDVLAHEWYNRGYHGSYHRNAKA
VINKYLGYFDMNPATLRPLAPTDAAPKYVAAMGGMDNVIKLGKEAFDKGEFRWCAEIVDK
AVFAEPSNKQARYLQADCLEQLGYQSESAGERNTYLMGAYELRNGVPKVSATKTAGADTV
VAMDTELFLDYLGVRLNGDKAAGIDYTINFVLPDVNEKFLVELENAHLNNLKGIQSENPD
MTLTLNRAQLNQVLMGKTTIQQLAKEGKAKIEGNAQALTDIAGMLDNFEFWFNIIEPKTK