Protein Info for CSW01_04045 in Vibrio cholerae E7946 ATCC 55056

Annotation: vibriobactin biosynthesis 4'-phosphopantetheinyl transferase VibD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details PF17837: 4PPT_N" amino acids 67 to 129 (63 residues), 72.2 bits, see alignment E=3.1e-24 PF01648: ACPS" amino acids 136 to 220 (85 residues), 49.5 bits, see alignment E=4e-17

Best Hits

KEGG orthology group: K02362, enterobactin synthetase component D [EC: 2.7.8.-] (inferred from 100% identity to vcm:VCM66_0738)

MetaCyc: 100% identical to VibD phosphopantetheinyl transferase (Vibrio cholerae O1 biovar El Tor str. N16961)
Holo-[acyl-carrier-protein] synthase. [EC: 2.7.8.7]; RXN-10988 [EC: 2.7.8.7]

Predicted SEED Role

"Phosphopantetheinyl transferase component of siderophore synthetase (EC 2.7.8.-)" in subsystem Iron acquisition in Vibrio (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-, 2.7.8.7

Use Curated BLAST to search for 2.7.8.- or 2.7.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>CSW01_04045 vibriobactin biosynthesis 4'-phosphopantetheinyl transferase VibD (Vibrio cholerae E7946 ATCC 55056)
MCRYARSYLLHAFDYTLFVKARLNMAFMISMPAIELAGLTIQVCQFDPQQFDEDQQHYLA
PPTYHSLHKAVVKRQAEFVAGRKLAQQALKQIGQGYDRPIAIGTHREPLWPAGITGSIAH
CDGWAVCTVLKAEHLSLGIDIEHRLAHQTASEVQAIIGTAQEWALLAQQFDLASAVTLLF
SAKESLFKALFPQVHLYLDFCDAQLSSLEPNKMSFTLTRVPNAAQQSCEVYFRWFEQQRV
LTVSVLPMLGKIEYHVPTLPT