Protein Info for CSW01_04030 in Vibrio cholerae E7946 ATCC 55056

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details amino acids 250 to 279 (30 residues), see Phobius details amino acids 296 to 318 (23 residues), see Phobius details amino acids 324 to 342 (19 residues), see Phobius details PF01032: FecCD" amino acids 34 to 344 (311 residues), 303.8 bits, see alignment E=6.2e-95

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to vcm:VCM66_0735)

Predicted SEED Role

"Ferric vibriobactin, enterobactin transport system, permease protein ViuD (TC 3.A.1.14.6)" in subsystem Iron acquisition in Vibrio (TC 3.A.1.14.6)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>CSW01_04030 iron ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MNELMGIRVASSKRENPTLAGRDYWLMGLMLVALMGLTISSVFVGSRDIPYAVTFDALFH
FDEQNTQHLLVHYLRVPRTGLAILVGAALGAAGVIMQAMTRNPLADPGILGVNAGAILMV
VIGIAGFGLTDMLHYLWFGLFGAAATSVGVYLLAGINQSPNPVRVVLAGAAMTVVLLSMT
HLIMLNSAQEVFNQFRHWSIGSLQGRGYEVLLPTSVFVLLGLIAAILLARGLDTVVLGHD
AGKALGVNPLWIWIASAAVVTLLAGTATAAAGPISFLGLTAPHLARLWVGAEHRRLLPYS
MLLGALLLLGADLAGRLIGSNDEISAGIMVALIGGPVFVLLVRRWKLSHL