Protein Info for CSW01_03985 in Vibrio cholerae E7946 ATCC 55056

Annotation: GMP synthase (glutamine-hydrolyzing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 10 to 197 (188 residues), 276.8 bits, E=6.5e-87
• PF00117: GATase
  • amino acids 11 to 191 (181 residues), 159.6 bits, E=1.8e-50
• PF07722: Peptidase_C26
  • amino acids 75 to 175 (101 residues), 26 bits, E=1.9e-09
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 205 to 517 (313 residues), 514.4 bits, E=1.1e-158
• PF02540: NAD_synthase
  • amino acids 210 to 285 (76 residues), 31.4 bits, E=2.8e-11
• PF00958: GMP_synt_C
  • amino acids 425 to 516 (92 residues), 146.8 bits, E=4e-47

Best Hits

Swiss-Prot: 100% identical to GUAA_VIBCH: GMP synthase [glutamine-hydrolyzing] (guaA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 100% identity to vco:VC0395_A0297)

MetaCyc: 81% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing], amidotransferase subunit (EC 6.3.5.2) / GMP synthase [glutamine-hydrolyzing], ATP pyrophosphatase subunit (EC 6.3.5.2)" (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (8/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (517 amino acids)

>CSW01_03985 GMP synthase (glutamine-hydrolyzing) (Vibrio cholerae E7946 ATCC 55056)
MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP
ESVTEANSPRAPQYVFDSGVPVFGVCYGMQTMAEQLGGRVATSDEREFGYAQVKISGESA
LFKDLDLTQDVWMSHGDKVVEIPADFVKIGETDTCPYAAMANEEKKYYGVQFHPEVTHTK
NGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGNDEVILGLSGGVDSSVVAMLVH
RAIGSKLTCVFVDNGLLRLNEGEQVMEMFGDKFGLNIIKVDAEERFLKALEGIDEPEAKR
KTIGRVFVEVFDEESKKLSNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDM
KMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD
AIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL
PYEFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE