Protein Info for CSW01_03975 in Vibrio cholerae E7946 ATCC 55056

Annotation: exodeoxyribonuclease VII large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 PF13742: tRNA_anti_2" amino acids 11 to 104 (94 residues), 106.8 bits, see alignment E=8.7e-35 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 12 to 356 (345 residues), 460.2 bits, see alignment E=3.1e-142 PF01336: tRNA_anti-codon" amino acids 31 to 105 (75 residues), 40.5 bits, see alignment E=3.2e-14 PF02601: Exonuc_VII_L" amino acids 127 to 440 (314 residues), 386.6 bits, see alignment E=1.6e-119

Best Hits

Swiss-Prot: 100% identical to EX7L_VIBCM: Exodeoxyribonuclease 7 large subunit (xseA) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 100% identity to vcj:VCD_003560)

MetaCyc: 57% identical to exodeoxyribonuclease VII subunit XseA (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease VII. [EC: 3.1.11.6]

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>CSW01_03975 exodeoxyribonuclease VII large subunit (Vibrio cholerae E7946 ATCC 55056)
MSSSLANRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSAPVSGHWYLTLKDSQAQVK
CAMFKGNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKM
QLAAEGLFAQTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE
EAAIQIAQAIGRANTRAECDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPIISAVGHE
IDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASTMRHYLAQQETQFARL
QHKLDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSPIHLIRQ
QRFNLIQQEQRINQSIQRYLIQSRHQLALLSEKLDAVSPLATLARGYSVTRTTQGELVRQ
SAQVKPGDTLVTQLMDGEILSTVNSR