Protein Info for CSW01_03880 in Vibrio cholerae E7946 ATCC 55056

Annotation: HTH-type transcriptional regulator IscR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 TIGR00738: Rrf2 family protein" amino acids 16 to 145 (130 residues), 155.4 bits, see alignment E=7.2e-50 TIGR02010: iron-sulfur cluster assembly transcription factor IscR" amino acids 16 to 149 (134 residues), 215.3 bits, see alignment E=2.4e-68 PF02082: Rrf2" amino acids 18 to 145 (128 residues), 133.7 bits, see alignment E=2.4e-43

Best Hits

Swiss-Prot: 100% identical to ISCR_VIBCH: HTH-type transcriptional regulator IscR (iscR) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K13643, Rrf2 family transcriptional regulator, iron-sulfur cluster assembly transcription factor (inferred from 100% identity to vco:VC0395_A0276)

Predicted SEED Role

"Iron-sulfur cluster regulator IscR" in subsystem Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>CSW01_03880 HTH-type transcriptional regulator IscR (Vibrio cholerae E7946 ATCC 55056)
MENFQPHKQCGYGVIMRLTSKGRYAVTAMLDVALHSQQNPVPLADISERQGISLSYLEQL
FSKLRKAGLVASVRGPGGGYRLGMDSYAISIGTVIAAVDESVDATKCNGKGDCQGGTRCL
THTLWRDLSSRITDFLNNITLGELMMDNEVLEVSDRQDLHLAVSQRVSQNNSNTVTIGAA
PFGINVRS