Protein Info for CSW01_03850 in Vibrio cholerae E7946 ATCC 55056

Annotation: tRNA guanosine(34) transglycosylase Tgt

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 TIGR00449: tRNA-guanine family transglycosylase" amino acids 5 to 370 (366 residues), 590.9 bits, see alignment E=8.3e-182 TIGR00430: tRNA-guanine transglycosylase" amino acids 5 to 371 (367 residues), 621.1 bits, see alignment E=6.2e-191 PF01702: TGT" amino acids 13 to 368 (356 residues), 566.6 bits, see alignment E=1.2e-174

Best Hits

Swiss-Prot: 100% identical to TGT_VIBCH: Queuine tRNA-ribosyltransferase (tgt) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00773, queuine tRNA-ribosyltransferase [EC: 2.4.2.29] (inferred from 100% identity to vco:VC0395_A0270)

MetaCyc: 81% identical to tRNA-guanine transglycosylase (Escherichia coli K-12 substr. MG1655)
tRNA-guanine transglycosylase. [EC: 2.4.2.29]

Predicted SEED Role

"tRNA-guanine transglycosylase (EC 2.4.2.29)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 2.4.2.29)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>CSW01_03850 tRNA guanosine(34) transglycosylase Tgt (Vibrio cholerae E7946 ATCC 55056)
MKLKFELKKKNGNARRGQLIFERGTVQTPAFMPVGTYGTVKGMTPEEVKETGAQILLGNT
FHLWLRPGQEVMKMHGDLHDFMNWQGPILTDSGGFQVFSLGDIRKITEEGVHFRNPVNGD
KIFMDAEKSMEIQKDLGSDIVMIFDECTPYPATHDEAKKSMEMSLRWAKRSRDHFDKLEN
PNNLFGIVQGGVYEDLRDVSVKGLTEIGFDGYAVGGLAVGEPKEDMHRVLEHTCPQLPED
KPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTGGVIKIRNAAHKTDTTPL
DPHCDCYTCKNYSKSYLHHLDRCNEILGARLNTIHNLRYYQRLMESIRKAIDEDRFDQFV
AEFYARRNREVPPLQKDKA