Protein Info for CSW01_03795 in Vibrio cholerae E7946 ATCC 55056

Annotation: phosphate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 TIGR00972: phosphate ABC transporter, ATP-binding protein" amino acids 27 to 273 (247 residues), 404.4 bits, see alignment E=7.8e-126 PF00005: ABC_tran" amino acids 42 to 198 (157 residues), 115.6 bits, see alignment E=4.2e-37

Best Hits

Swiss-Prot: 100% identical to PSTB1_VIBCH: Phosphate import ATP-binding protein PstB 1 (pstB1) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 100% identity to vco:VC0395_A0260)

MetaCyc: 61% identical to phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.27

Use Curated BLAST to search for 3.6.3.27 or 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>CSW01_03795 phosphate ABC transporter ATP-binding protein (Vibrio cholerae E7946 ATCC 55056)
MYSANPTLGYYVPPLDVNNLTDQQTAISIEHLSLYYQQSRALSDISMRIPKGQVTAFIGP
SGCGKSTLLRCINRMNDLVEGTRVEGEVKLHGKNIYHPDVDVPTLRRRVGMVFQRPNPFP
KSIYENVVYGLRLQGIKNSRALDDAAEQSLRAAALWDEVKHRLHENAFGLSGGQQQRLVI
ARAIAIEPEVLLLDEPTSALDPISTLTIEELIHDLKTKYTVVIVTHNMQQAARVSDHTAF
IHMGKLIEYADTDSIFTSPLKKQTEDYITGRYG