Protein Info for CSW01_03690 in Vibrio cholerae E7946 ATCC 55056

Annotation: outer membrane protein assembly factor BamD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 9 to 239 (231 residues), 265.1 bits, see alignment E=2.7e-83 PF13512: TPR_18" amino acids 22 to 165 (144 residues), 225.1 bits, see alignment E=3.9e-71 PF13525: YfiO" amino acids 27 to 235 (209 residues), 281.8 bits, see alignment E=3.5e-88

Best Hits

Swiss-Prot: 100% identical to BAMD_VIBCH: Outer membrane protein assembly factor BamD (bamD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K05807, putative lipoprotein (inferred from 99% identity to vco:VC0395_A0237)

Predicted SEED Role

"Probable component of the lipoprotein assembly complex (forms a complex with YaeT, YfgL, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>CSW01_03690 outer membrane protein assembly factor BamD (Vibrio cholerae E7946 ATCC 55056)
MKYQTLSGLLALSLLFGCSSSPDVVPDVPPSQLYSEAQTALQSGTWLTAIEKLEALDSRY
PFGAYSEQVQLDLIYAYYKNDDLALGLATIERFTRLNPTHEKMDWVLYMRGLTHMAQDRN
FMHDLFNIDRRDRDPEPVKAAFADFKKLLQRYPNSPYAEDAQRRMFALKNRLAEYDLATA
DFYLRREAWIAAINRTQELQKTYPDTEAARKSLEIQLEAYQQLGLTDAIERTKQLMQLNP
L