Protein Info for CSW01_03675 in Vibrio cholerae E7946 ATCC 55056

Annotation: norspermidine sensor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF01547: SBP_bac_1" amino acids 47 to 288 (242 residues), 54.8 bits, see alignment E=2.3e-18 PF13416: SBP_bac_8" amino acids 50 to 307 (258 residues), 66.2 bits, see alignment E=6.3e-22 PF13343: SBP_bac_6" amino acids 91 to 315 (225 residues), 42.7 bits, see alignment E=7.5e-15

Best Hits

Swiss-Prot: 100% identical to NSPS_VIBCH: Norspermidine sensor (nspS) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 100% identity to vch:VC0704)

Predicted SEED Role

"Predicted polyamine sensor NspS, involved in biofilm formation" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>CSW01_03675 norspermidine sensor (Vibrio cholerae E7946 ATCC 55056)
MTNFCNEWVSYSQMIKRFLSLMVLNTVCYQASALELNVYLWEDTIAPSVVEAWHKKTGVS
VNLFHFDNDDERSLLMLKSVQLPFDIMVLDNVSAFIFSRQNVFEDLTALPNRANNDPMWL
QACGTHAVPYFWGSVGIAYRKSLFDKPPTQWSEVVDIAPAHRGRVGMLKDSVETLLPALY
MLNASPITDSIDTLRQAYRLLDAANPHILTYEYVLSYVRSHPQTDNLHMAVSYSGDHYSL
NRFFNTQDWDFSVPEGRPYLWVDCMAVNSVSPNTVQAKAFLDFLMKPDIAAINAEYIRAA
SPNYKARALLPVEHREDLSIYLPEQRLAEGIIDSELSAKNLSLRAKIISSVTYQYEAKP