Protein Info for CSW01_03665 in Vibrio cholerae E7946 ATCC 55056

Annotation: non-canonical purine NTP phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 TIGR00258: inosine/xanthosine triphosphatase" amino acids 15 to 180 (166 residues), 161.7 bits, see alignment E=8.8e-52 PF01931: NTPase_I-T" amino acids 16 to 175 (160 residues), 197.3 bits, see alignment E=8e-63

Best Hits

Swiss-Prot: 100% identical to NCPP_VIBCM: Inosine/xanthosine triphosphatase (VCM66_0660) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_0660)

MetaCyc: 46% identical to inosine/xanthosine triphosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-5073 [EC: 3.6.1.73]; 3.6.1.73 [EC: 3.6.1.73]

Predicted SEED Role

"Inosine/xanthosine triphosphatase (EC 3.6.1.-); Hypothetical cytoplasmic protein in cluster with NspS" (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.73

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>CSW01_03665 non-canonical purine NTP phosphatase (Vibrio cholerae E7946 ATCC 55056)
MPPIIKRRVMRKIIIASQNPAKVNAVRSAFSTVFPDQEWEFIGVSVPSEVADQPMSDEET
KQGALNRVRNAKQRHPGAEYYVGLEAGIEENKTFAWMIVESDQQRGESRSACLMLPPLVL
ERLRQAKELGDVMDEVFGTENIKQKGGAIGLLTRHHLTRSTVYHQALILALIPFINPEHY
PSA