Protein Info for CSW01_03580 in Vibrio cholerae E7946 ATCC 55056

Annotation: lipoprotein signal peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 10 to 166 (157 residues), 168 bits, see alignment E=8.4e-54 PF01252: Peptidase_A8" amino acids 18 to 161 (144 residues), 146.3 bits, see alignment E=3.6e-47

Best Hits

Swiss-Prot: 100% identical to LSPA_VIBCH: Lipoprotein signal peptidase (lspA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 99% identity to vco:VC0395_A0215)

MetaCyc: 54% identical to lipoprotein signal peptidase (Escherichia coli K-12 substr. MG1655)
Signal peptidase II. [EC: 3.4.23.36]

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>CSW01_03580 lipoprotein signal peptidase (Vibrio cholerae E7946 ATCC 55056)
MSNSSLALKQSGLRWLWLALLVFIADITIKLIVMDNMGYGWANRIEVLPFFNLLYVHNYG
AAFSFLSDQEGWQRWLFTGIAFVVTGMLAYWMRRLPASDKWNNIAYALIIGGAVGNVFDR
IVHGFVVDYLDFYWGTYHWPAFNLADSTICIGAAMIILDGFRAKKSAPSQS