Protein Info for CSW01_03555 in Vibrio cholerae E7946 ATCC 55056

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 PF12840: HTH_20" amino acids 28 to 77 (50 residues), 34.4 bits, see alignment E=4.2e-12 PF13412: HTH_24" amino acids 30 to 74 (45 residues), 24.6 bits, see alignment E=3.8e-09 PF01022: HTH_5" amino acids 31 to 75 (45 residues), 62.7 bits, see alignment E=5.6e-21 PF08279: HTH_11" amino acids 32 to 72 (41 residues), 22.6 bits, see alignment E=2e-08 PF12802: MarR_2" amino acids 34 to 78 (45 residues), 27.4 bits, see alignment E=7.8e-10

Best Hits

Swiss-Prot: 100% identical to HLYU_VIBCH: Transcriptional activator HlyU (hlyU) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_0636)

Predicted SEED Role

"Transcriptional activator HlyU"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>CSW01_03555 transcriptional regulator (Vibrio cholerae E7946 ATCC 55056)
MPYLKGAPMNLQEMEKNSAKAVVLLKAMANERRLQILCMLLDNELSVGELSSRLELSQSA
LSQHLAWLRRDGLVNTRKEAQTVFYTLSSTEVKAMIELLHRLYCQANQ