Protein Info for CSW01_03500 in Vibrio cholerae E7946 ATCC 55056

Annotation: sigma-54-dependent Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 PF20161: VpsR" amino acids 3 to 122 (120 residues), 168 bits, see alignment E=2e-53 PF00158: Sigma54_activat" amino acids 146 to 305 (160 residues), 141.4 bits, see alignment E=7.2e-45 PF14532: Sigma54_activ_2" amino acids 147 to 310 (164 residues), 67.3 bits, see alignment E=5.5e-22 PF25601: AAA_lid_14" amino acids 311 to 381 (71 residues), 78 bits, see alignment E=1.2e-25 PF02954: HTH_8" amino acids 396 to 435 (40 residues), 31.2 bits, see alignment 4.6e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A0196)

Predicted SEED Role

"Transcriptional regulator VpsR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>CSW01_03500 sigma-54-dependent Fis family transcriptional regulator (Vibrio cholerae E7946 ATCC 55056)
MSTQFRMDSVPGSLVVVGGTYEPWLAVLEKVGWRCTQVADLRKADALFVETGPCIGIVDL
SHDEFSLNGIANLVSSHKQVRWLAFIREAQLSSDTICQFIVNFCIDFFTAPIPDAQLLST
IGHQLGMLKLEKKVWPHFGSAGNMGLIGESMPMKRLRDQIKRIGPTDVSILIYGESGTGK
ETVAKAIHKTSSRAQKPFISVNCRAMSEKRLESELFGLGETEEGQQPFLLQADGGTLLLN
DILTLPKSQQLNLLRFLQEGTVETRQGVRAVDVRILAANSSDIEKALIDGDFNEELYHYI
NVLRINVPSLKERASDIVLLAKHFLQEYSKEYNAQARSFSDDAVRGLTRYHWPGNVRELM
NQIKRVVLMSDTVVLDESQLDLPKRSDGRRSLKSIRERSERDALLLVLESHSGQVSTAAK
ELGVSRATMYRLLNKHNLITDENF