Protein Info for CSW01_03485 in Vibrio cholerae E7946 ATCC 55056

Annotation: branched-chain amino acid transport system II carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 282 to 306 (25 residues), see Phobius details amino acids 318 to 338 (21 residues), see Phobius details amino acids 344 to 361 (18 residues), see Phobius details amino acids 370 to 391 (22 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details PF05525: Branch_AA_trans" amino acids 8 to 426 (419 residues), 536.5 bits, see alignment E=2.6e-165 TIGR00796: branched-chain amino acid transport system II carrier protein" amino acids 14 to 413 (400 residues), 444.8 bits, see alignment E=1.6e-137

Best Hits

Swiss-Prot: 48% identical to BRAZ_PSEAE: Branched-chain amino acid transport system 3 carrier protein (braZ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03311, branched-chain amino acid:cation transporter, LIVCS family (inferred from 100% identity to vch:VC0662)

MetaCyc: 44% identical to branched chain amino acid transporter BrnQ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-126; TRANS-RXN-126A; TRANS-RXN-126B

Predicted SEED Role

"Branched-chain amino acid transport system carrier protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>CSW01_03485 branched-chain amino acid transport system II carrier protein (Vibrio cholerae E7946 ATCC 55056)
MKQTLKLADILALGFMLFAFFLGAGNIIFPPLAGQLAGENITPAMFGFLLTAVGLPLITI
IAIAVAGGSWEHLTKDLPVKASVLMAALILIVIGPAFAAPRTGLVAYEMAVKPFFAESTQ
SYLTLFSVLFFAVAMFFSWSQGKLVDLIGKLLTPALFICLIILALGVFMNPQGEMIAAQG
EYLSQPLTKGFLEGYNTMDTFASLMFGILIVDALRSKGITDRAATTRYLITSAVIAAIGL
ALVYGSLFYLGATSSSVAAGANNGGAILSQYVQALFGSYGQLVLSVIVMLACLTTAVGLI
SACSDFFSKHTSLSYKQWVVINGVACGVVANVGLAQLITLSIPVLFALYPVAIALVALTF
VRHKLPNPRVAYRAVLSVSLLVALLDAAKVAGFDVSAFSFLPFFEYGMGWLLPTCAAMIC
MFFIPSASSPVLEEELA