Protein Info for CSW01_03365 in Vibrio cholerae E7946 ATCC 55056

Annotation: preprotein translocase subunit SecG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 51 to 71 (21 residues), see Phobius details TIGR00810: preprotein translocase, SecG subunit" amino acids 3 to 73 (71 residues), 90.4 bits, see alignment E=3e-30 PF03840: SecG" amino acids 4 to 72 (69 residues), 82.8 bits, see alignment E=7.5e-28

Best Hits

KEGG orthology group: K03075, preprotein translocase subunit SecG (inferred from 100% identity to vcm:VCM66_0598)

Predicted SEED Role

"Preprotein translocase subunit SecG (TC 3.A.5.1.1)" in subsystem Murein hydrolase regulation and cell death (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (111 amino acids)

>CSW01_03365 preprotein translocase subunit SecG (Vibrio cholerae E7946 ATCC 55056)
MFTVLLVIYLLAAVAIIGLVLIQQGKGADMGASFGAGASNTVFGASGSGNFLTRMTAIFA
TVFFVISLVLGNMSTHKTESQWVDPSQGQVIQQAGDSVSEAPAKSSDEIPQ