Protein Info for CSW01_03355 in Vibrio cholerae E7946 ATCC 55056

Annotation: phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 PF02878: PGM_PMM_I" amino acids 5 to 137 (133 residues), 154.1 bits, see alignment E=3.8e-49 TIGR01455: phosphoglucosamine mutase" amino acids 8 to 443 (436 residues), 685.8 bits, see alignment E=1.2e-210 PF02879: PGM_PMM_II" amino acids 158 to 255 (98 residues), 59.9 bits, see alignment E=6.4e-20 PF02880: PGM_PMM_III" amino acids 259 to 367 (109 residues), 112.3 bits, see alignment E=3e-36 PF00408: PGM_PMM_IV" amino acids 376 to 440 (65 residues), 57.4 bits, see alignment E=2.4e-19

Best Hits

Swiss-Prot: 100% identical to GLMM_VIBCH: Phosphoglucosamine mutase (glmM) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 100% identity to vco:VC0395_A0168)

MetaCyc: 77% identical to phosphoglucosamine mutase (Escherichia coli K-12 substr. MG1655)
Phosphoglucosamine mutase. [EC: 5.4.2.10]

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>CSW01_03355 phosphoglucosamine mutase (Vibrio cholerae E7946 ATCC 55056)
MSDKRRYFGTDGVRGKVGQYPITPDFVLKLGWAAGRVLAKQGTRKVIIGKDTRISGYMLE
SALEAGLAAAGLKATFTGPMPTPAVAYLTQTFRAEAGIVISASHNPYYDNGIKFFSYEGT
KLPDDIELAIEAELDKDIECVESAELGKASRMVDAAGRYIEFCKSTFPSKLSLSGLKLVV
DCANGATYHIAPNVFRELGAEVIAMGVEPNGLNINDQVGATDVRALQKRVVEEHAHLGLA
FDGDGDRIIMVDHLGNKVDGDQIAYIIARDALRRGELKGGVVGTLMTNLGMENGLKQLGI
PFVRAAVGDRYVMEKLLEKGWKIGAENSGHVILLDKVTTGDAIVAGLQVLASVVGSEMTL
HELAKGMTLYPQVLENVRFAGDNNPLEADAVKAAVSEVEAELGSKGRVLLRKSGTEPLIR
VMVEGEDETLVKQSALKIAQAVKDNC