Protein Info for CSW01_03350 in Vibrio cholerae E7946 ATCC 55056

Annotation: dihydropteroate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01496: dihydropteroate synthase
  • amino acids 18 to 273 (256 residues), 351.7 bits, E=1.4e-109
• PF00809: Pterin_bind
  • amino acids 19 to 259 (241 residues), 304.6 bits, E=3e-95

Best Hits

Swiss-Prot: 59% identical to DHPS_ECOLI: Dihydropteroate synthase (folP) from Escherichia coli (strain K12)

KEGG orthology group: K00796, dihydropteroate synthase [EC: 2.5.1.15] (inferred from 100% identity to vcm:VCM66_0596)

MetaCyc: 59% identical to dihydropteroate synthase (Escherichia coli K-12 substr. MG1655)
Dihydropteroate synthase. [EC: 2.5.1.15]

Predicted SEED Role

"Dihydropteroate synthase (EC 2.5.1.15)" in subsystem Folate Biosynthesis (EC 2.5.1.15)

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• tetrahydrofolate biosynthesis II (2/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.15

Protein Sequence (278 amino acids)

>CSW01_03350 dihydropteroate synthase (Vibrio cholerae E7946 ATCC 55056)
MLKISHADKQLELHSPVVMGILNTTPDSFSDGGRYVDLDVALARAQQMIDLGVAIIDIGG
ESTRPGAPDVALEEELQRVIPLIKAIRKQNAEVWISIDTSKAEVMRQALAAGADLINDVR
ALQEPGALEVAAQAQVPVCIMHMQGQPRTMQANPHYYNIIEEVCQFLAERIAQCEAAGIK
RENIILDPGFGFGKSVQHNYHLLAHLEQFHRFGLPVLAGMSRKSMIFKTLNKQPAECVAG
SVACATLAAQKGAQIIRVHDVEQTIDALKMVQMMHNNL