Protein Info for CSW01_03345 in Vibrio cholerae E7946 ATCC 55056

Annotation: ATP-dependent zinc metalloprotease FtsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 651 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 102 to 123 (22 residues), see Phobius details PF06480: FtsH_ext" amino acids 8 to 97 (90 residues), 56.8 bits, see alignment E=7.1e-19 TIGR01241: ATP-dependent metallopeptidase HflB" amino acids 105 to 597 (493 residues), 805.1 bits, see alignment E=1.2e-246 PF07728: AAA_5" amino acids 191 to 312 (122 residues), 25.9 bits, see alignment E=2.7e-09 PF00004: AAA" amino acids 192 to 324 (133 residues), 161.2 bits, see alignment E=5.3e-51 PF17862: AAA_lid_3" amino acids 347 to 390 (44 residues), 43.2 bits, see alignment 6.9e-15 PF01434: Peptidase_M41" amino acids 405 to 595 (191 residues), 243.9 bits, see alignment E=3.8e-76

Best Hits

Swiss-Prot: 84% identical to FTSH_PHOPR: ATP-dependent zinc metalloprotease FtsH (ftsH) from Photobacterium profundum (strain SS9)

KEGG orthology group: K03798, cell division protease FtsH [EC: 3.4.24.-] (inferred from 100% identity to vcj:VCD_003774)

MetaCyc: 79% identical to ATP-dependent zinc metalloprotease FtsH (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (651 amino acids)

>CSW01_03345 ATP-dependent zinc metalloprotease FtsH (Vibrio cholerae E7946 ATCC 55056)
MSDMAKNLILWLVIAVVLMSVFQSFGPGENNGRAVDYTTFVKEVGQGQIQEAQFNNGEIT
FMRRGGGSRYVTYMPVYDQKLLDDLINQDVKVQGTPPEEQSLLGTIFISWFPMILLIGVW
IFFMRQMQGGGGKGAMSFGKSKARMMSEDQIKTTFSDVAGCDEAKEDVKELVDYLRDPSR
FQKLGGKIPTGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDM
FEQAKKASPCIIFIDEIDAVGRQRGAGVGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAA
TNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRKVPLANDVEPSLIARGTPGF
SGADLANLVNEAALFAARGNKRNVSMVEFELAKDKIMMGAERRSMVMSEEIKESTAYHEA
GHAVVGRLVPEHDPVYKVSIIPRGRALGVTMYLPEQDRVSMSKQHLESMISSLYGGRLAE
ELIYGKEKVSTGASNDIERATEIARKMVTQWGFSEKLGPMLYAEDEGEVFLGRSVTQTKH
MSDDTAKLIDDEVRQIIDRNYERARQIIMDNMDIMHAMKDALMKYETIDAGQIDDLMARK
PVIREPAGWGEQSKTPSAPEVKAEPEAKAEESTAETASSDVATASEKKDAE