Protein Info for CSW01_03250 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF00005: ABC_tran" amino acids 26 to 182 (157 residues), 105.2 bits, see alignment E=6.8e-34 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 232 to 317 (86 residues), 76.6 bits, see alignment E=6.1e-26 PF08352: oligo_HPY" amino acids 233 to 297 (65 residues), 73 bits, see alignment E=3.1e-24

Best Hits

Swiss-Prot: 43% identical to Y1052_BRUA2: Putative peptide import ATP-binding protein BAB2_1052 (BAB2_1052) from Brucella abortus (strain 2308)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to vco:VC0395_A0146)

Predicted SEED Role

"(GlcNAc)2 ABC transporter, ATP-binding component 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>CSW01_03250 ABC transporter ATP-binding protein (Vibrio cholerae E7946 ATCC 55056)
MTTPLISIRNLCVDYITDAGDVRACNNVSFDLAPGEVFGLAGESGCGKSTVAFSLMRLHK
PPAFITGGEVIFNGEDILKYSDERMQAFRWKEMSMVFQSAMNALNPVLTMEEQFCDVITR
HTNMTREQAKRRAEGLLEIVDIHPSRLNDYPHQFSGGMRQRLVIAIALALNPKMIIMDEP
TTALDVVVQREILQKIYALKEEFGFSILFITHDLSLMVEFSDRIGIMYSGELIEVAPSKQ
ILETPYHPYTKGLGSSFPPLTGPKTKLTGIPGNPLNLLDIPQGCRFQARCDRVHEACTKV
PTVLRQIEHGRFSNCHLYTQSNATIKR