Protein Info for CSW01_03245 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF00005: ABC_tran" amino acids 35 to 192 (158 residues), 112.2 bits, see alignment E=3e-36 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 241 to 328 (88 residues), 78.3 bits, see alignment E=1.9e-26 PF08352: oligo_HPY" amino acids 243 to 308 (66 residues), 67.3 bits, see alignment E=1.3e-22

Best Hits

Swiss-Prot: 40% identical to APPF_BACSU: Oligopeptide transport ATP-binding protein AppF (appF) from Bacillus subtilis (strain 168)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to vcj:VCD_003793)

Predicted SEED Role

"(GlcNAc)2 ABC transporter, ATP-binding component 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>CSW01_03245 ABC transporter ATP-binding protein (Vibrio cholerae E7946 ATCC 55056)
MSKPHGELLVEGKNLVKDFAINSNALKQPMMRAINDVSFKMYKSRGLSVVGESGSGKSTT
AKMIAKMYAPTSGVIEYKGRDIQDIVSRDDLMHYREGVQMVWQDPFGSLNPTHTIFHHIA
RPLLIHKKVTPGNKKELEERVYELLEQVGLIPPKATAAKYPHQLSGGQRQRVNLARNIAV
GAEVVLADEPTSMLDVSIRAGVLNLMEEMKFERQMSLLYITHDIATARYIAEDLAVMYVG
HMVEWGDTDEIIHDPQHPYTKLLVSAVPDPKKSIHEKLEGNKGEIPLWTPNSVGCPFAGR
CLYASAKCREALPEVTQLSDNHFVRCYLFEK