Protein Info for CSW01_03155 in Vibrio cholerae E7946 ATCC 55056

Annotation: RNA polymerase-binding transcription factor DksA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR02420: RNA polymerase-binding protein DksA" amino acids 29 to 137 (109 residues), 168.6 bits, see alignment E=2.4e-54 PF21157: DksA_N" amino acids 33 to 103 (71 residues), 114.8 bits, see alignment E=1.7e-37 PF01258: zf-dskA_traR" amino acids 107 to 139 (33 residues), 40.7 bits, see alignment 1.9e-14

Best Hits

Swiss-Prot: 85% identical to DKSA_SALTY: RNA polymerase-binding transcription factor DksA (dksA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K06204, DnaK suppressor protein (inferred from 100% identity to vcj:VCD_003811)

Predicted SEED Role

"C4-type zinc finger protein, DksA/TraR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>CSW01_03155 RNA polymerase-binding transcription factor DksA (Vibrio cholerae E7946 ATCC 55056)
MTESKKKTLGILAIAGVEPYQEKPGEEYMSPGQITHFTKILEAWRNQLREEVDRTVHHMQ
DEAANFPDPVDRASQEEEFSLELRNRDRERRLIKKIEKTLDKIKEEDFGYCESCGVEIGI
RRLEARPTADLCIDCKTLAEIKEKQMLG