Protein Info for CSW01_03120 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 20 to 164 (145 residues), 122.1 bits, E=2.8e-39
• PF13304: AAA_21
  • amino acids 131 to 193 (63 residues), 34.1 bits, E=2.9e-12

Best Hits

Swiss-Prot: 73% identical to YADG_ECOLI: Uncharacterized ABC transporter ATP-binding protein YadG (yadG) from Escherichia coli (strain K12)

KEGG orthology group: K09687, antibiotic transport system ATP-binding protein (inferred from 100% identity to vco:VC0395_A0120)

Predicted SEED Role

"ABC-type multidrug transport system, ATPase component"

Protein Sequence (305 amino acids)

>CSW01_03120 ABC transporter ATP-binding protein (Vibrio cholerae E7946 ATCC 55056)
MYALEIEQLRKTYAGGFEALKGISLQVKKGDFYALLGPNGAGKSTTIGIISSLVNKTSGK
VTVFGYDLDSQLELAKQKLGLVPQEFNFNPFETVEQIVLQQAGYYGVPKALAKERAKKYL
TQLDLWEKRSERARNLSGGMKRRLMIARALMHEPQLLILDEPTAGVDIELRRSMWEFLKQ
INAQGVTIILTTHYLEEAEMLCRHIGIIQRGELIENTTMKSLLGKLHVETFVLDVDGNAP
IAPLQGVVKQQMVEGSLEIELEKSQGINHVFTQLTEQGVKVLSMRNKVNRLEELFVSIVN
SGKRG