Protein Info for CSW01_03090 in Vibrio cholerae E7946 ATCC 55056

Annotation: rRNA (cytidine-2'-O-)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 TIGR00096: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase" amino acids 13 to 284 (272 residues), 337.4 bits, see alignment E=3.3e-105 PF00590: TP_methylase" amino acids 14 to 213 (200 residues), 111.3 bits, see alignment E=6.8e-36 PF23016: RsmI_C" amino acids 242 to 285 (44 residues), 60.8 bits, see alignment 9.2e-21

Best Hits

Swiss-Prot: 100% identical to RSMI_VIBCH: Ribosomal RNA small subunit methyltransferase I (rsmI) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07056, (no description) (inferred from 100% identity to vch:VC0582)

MetaCyc: 67% identical to 16S rRNA 2'-O-ribose C1402 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11637 [EC: 2.1.1.198]

Predicted SEED Role

"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.198

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>CSW01_03090 rRNA (cytidine-2'-O-)-methyltransferase (Vibrio cholerae E7946 ATCC 55056)
MTDNKTVPNGAPILYIVPTPIGNLGDITQRALDVLASVDMIAVEDTRHTGKLLAHFNIST
KTFALHDHNEQQKAQVLVDKLLSGLSIALVSDAGTPLISDPGYHLVTQCRQAGVKVVPLP
GPCAVITALSASGLPSDSFSFEGFLPAKSKARKDKLLEIAKVSRTCIFYESPHRICESLQ
DMLDVLGGEREVVLARELTKTFETIQGMPLAELITWIAEDDNRKKGEMVLLVHGYRDAGE
QQLPDEALRTLTILTKELPLKKAAALVAEIHQLKKNALYKWGLENLGE