Protein Info for CSW01_03045 in Vibrio cholerae E7946 ATCC 55056

Annotation: ubiquinol-cytochrome c reductase iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF10399: UCR_Fe-S_N" amino acids 8 to 40 (33 residues), 41.9 bits, see alignment 5.4e-15 TIGR01416: ubiquinol-cytochrome c reductase, iron-sulfur subunit" amino acids 9 to 190 (182 residues), 248.5 bits, see alignment E=2e-78 PF00355: Rieske" amino acids 53 to 171 (119 residues), 33.4 bits, see alignment E=3.4e-12

Best Hits

KEGG orthology group: K00411, ubiquinol-cytochrome c reductase iron-sulfur subunit [EC: 1.10.2.2] (inferred from 100% identity to vco:VC0395_A0105)

Predicted SEED Role

"Ubiquinol-cytochrome C reductase iron-sulfur subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>CSW01_03045 ubiquinol-cytochrome c reductase iron-sulfur subunit (Vibrio cholerae E7946 ATCC 55056)
MSNAPLNQGRRRFLTATTAVVGGLGAVAVAVPFIKSWNPSAKAKAAGAPVEVEISKLEEG
QMVRVEWRGKPVWVVRRSQAVVEGLKSHENQLRDPNSDELQQPNYAQNPYRSIKPEYFIA
VGICTHLGCSPTYLPDSFSEQVQGVKSGFFCPCHGSKFDMAGRVFQAVPAPLNLVIPPHM
YLSDTRIVIGLDETGEA