Protein Info for CSW01_02960 in Vibrio cholerae E7946 ATCC 55056

Annotation: DedA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 54 to 79 (26 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details PF09335: VTT_dom" amino acids 45 to 148 (104 residues), 39.8 bits, see alignment E=2.9e-14

Best Hits

Swiss-Prot: 53% identical to YQAA_SHIFL: Inner membrane protein YqaA (yqaA) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to vch:VC0553)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>CSW01_02960 DedA family protein (Vibrio cholerae E7946 ATCC 55056)
MLDWWNDSSALLTSLFAESPLSLLFWSGFLSATLLPGGSEAALLASLSLAQHPVWLIVAV
STAGNTLGGMTNYALGLWLPHRTDSQKQGHKAKLWLQRYGYWALLGSWLPIIGDPLCLAA
GWLRLNVLPAFLMILIGKALRYSLLAALYYGLF