Protein Info for CSW01_02940 in Vibrio cholerae E7946 ATCC 55056

Annotation: oxaloacetate decarboxylase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01195: sodium pump decarboxylases, gamma subunit
  • amino acids 5 to 83 (79 residues), 90 bits, E=5.6e-30
• PF04277: OAD_gamma
  • amino acids 10 to 80 (71 residues), 75.1 bits, E=2.9e-25

Best Hits

Swiss-Prot: 100% identical to OADG1_VIBCH: Probable oxaloacetate decarboxylase gamma chain 1 (oadG1) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01573, oxaloacetate decarboxylase, gamma subunit [EC: 4.1.1.3] (inferred from 100% identity to vco:VC0395_A0084)

Predicted SEED Role

"Oxaloacetate decarboxylase gamma chain (EC 4.1.1.3)" in subsystem Na+ translocating decarboxylases and related biotin-dependent enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 4.1.1.3)

MetaCyc Pathways

• methylgallate degradation (2/6 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (3/8 steps found)
• superpathway of vanillin and vanillate degradation (3/10 steps found)
• syringate degradation (3/12 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.3

Use Curated BLAST to search for 4.1.1.3

Protein Sequence (86 amino acids)

>CSW01_02940 oxaloacetate decarboxylase subunit gamma (Vibrio cholerae E7946 ATCC 55056)
MTHIGSLLLDAATLMVTGMAVVFLFLTLLVYLVQFMSRVIPQEVPEAAATPKKSQKVQPV
TDSVSPQVVAAIAAAVHQHRSATAKQ