Protein Info for CSW01_02880 in Vibrio cholerae E7946 ATCC 55056

Annotation: regulatory protein RecX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF21982: RecX_HTH1" amino acids 8 to 45 (38 residues), 55.5 bits, see alignment E=6.5e-19 PF02631: RecX_HTH2" amino acids 54 to 94 (41 residues), 46.2 bits, see alignment E=6.6e-16 PF21981: RecX_HTH3" amino acids 100 to 145 (46 residues), 47.2 bits, see alignment E=3.1e-16

Best Hits

Swiss-Prot: 100% identical to RECX_VIBCM: Regulatory protein RecX (recX) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K03565, regulatory protein (inferred from 99% identity to vco:VC0395_A0071)

Predicted SEED Role

"Regulatory protein RecX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>CSW01_02880 regulatory protein RecX (Vibrio cholerae E7946 ATCC 55056)
MSFDLATCRQSALQLLSRRDHSEYELYQKLALKGHPAEVIDEVVKYVLELGYLSDARYAA
SQARQIVHKGYGEQRLRQQLKEKRVAEEVIEQALAEQTIDWFELAKEVAHKKFKSGISHE
RSQYAKQVRYLQYRGFNFEQIRYALQASESDE