Protein Info for CSW01_02865 in Vibrio cholerae E7946 ATCC 55056

Annotation: sulfate/thiosulfate import ATP-binding protein CysA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 TIGR00968: sulfate ABC transporter, ATP-binding protein" amino acids 3 to 242 (240 residues), 382.9 bits, see alignment E=2.9e-119 PF00005: ABC_tran" amino acids 19 to 164 (146 residues), 133.7 bits, see alignment E=1e-42 PF13304: AAA_21" amino acids 112 to 196 (85 residues), 28.5 bits, see alignment E=2.3e-10 PF12857: TOBE_3" amino acids 288 to 346 (59 residues), 54 bits, see alignment E=1.9e-18

Best Hits

Swiss-Prot: 100% identical to CYSA_VIBCH: Sulfate/thiosulfate import ATP-binding protein CysA (cysA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02045, sulfate transport system ATP-binding protein [EC: 3.6.3.25] (inferred from 100% identity to vco:VC0395_A0068)

Predicted SEED Role

"Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)" in subsystem Cysteine Biosynthesis (EC 3.6.3.25)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>CSW01_02865 sulfate/thiosulfate import ATP-binding protein CysA (Vibrio cholerae E7946 ATCC 55056)
MSIRLDNISKHFGQFQALAPLSLKIEDGEMIGLLGPSGSGKTTLLRIIAGLEGADSGTIH
FRNRDVTNVHVRDRRVGFVFQNYALFRHMTVADNVAFGLQVMERAQRPNPAEIQKRVKQL
LEIVQLGHLAHRYPEQLSGGQKQRIALARALATQPEVLLLDEPFGALDAKVRKELRRWLR
SLHDELGFTSVFVTHDQDEALELSDRVVVMSNGRIEQIDSPVELYAQPNSRFVFDFFGNV
NQFAGEWQNGQWVNGSAFIQPPESDATRQSGLLYVRSHELALSDKENSQASLPFEVVSIN
PVGAEVRVELASVGWQSQELWEAKLSHRSLSEKRLSRGDQVFATPQVGYFFASEGQSSPS
VLRWPFLAPGSLMFEI