Protein Info for CSW01_02820 in Vibrio cholerae E7946 ATCC 55056

Annotation: 5'-nucleotidase SurE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00087: 5'/3'-nucleotidase SurE
  • amino acids 14 to 245 (232 residues), 247.1 bits, E=9.1e-78
• PF01975: SurE
  • amino acids 16 to 195 (180 residues), 221.1 bits, E=5.7e-70

Best Hits

Swiss-Prot: 100% identical to SURE_VIBC3: 5'-nucleotidase SurE (surE) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K03787, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 100% identity to vch:VC0531)

Predicted SEED Role

"5-nucleotidase SurE (EC 3.1.3.5) @ Exopolyphosphatase (EC 3.6.1.11)" (EC 3.1.3.5, EC 3.6.1.11)

MetaCyc Pathways

• polyphosphate metabolism (2/2 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• adenosine nucleotides degradation II (3/5 steps found)
• guanosine nucleotides degradation III (2/4 steps found)
• guanosine nucleotides degradation I (1/4 steps found)
• guanosine nucleotides degradation II (1/4 steps found)
• ureide biosynthesis (3/7 steps found)
• adenosine nucleotides degradation I (3/8 steps found)
• NAD salvage (plants) (5/11 steps found)
• superpathway of guanosine nucleotides degradation (plants) (1/6 steps found)
• tunicamycin biosynthesis (2/9 steps found)
• purine nucleotides degradation I (plants) (4/12 steps found)
• superpathway of purines degradation in plants (4/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5, 3.6.1.11

Use Curated BLAST to search for 3.1.3.5 or 3.6.1.11

Protein Sequence (263 amino acids)

>CSW01_02820 5'-nucleotidase SurE (Vibrio cholerae E7946 ATCC 55056)
MNKRAAIQRAKIKMKILLSNDDGVYAQGIHALADALRDLAEIVIVAPDRNRSGASNSLTL
EHPLRVSQIAENTYSVQGTPTDCVHFALNELMKDALPDLVLSGINHGANLGDDVLYSGTV
AAAMEGHFLGVQSIAFSLAGTTHFASAAHFVRQLVEQHLANPIPTNRLLNVNIPDRPLEL
IQGIEVTRLGARHHAESMIKQKDPRGHDIYWLGPPGKEQDAGPGTDFHAIERGWVSLTPL
QVDLTAHESLRSMDHWLKEKVNG