Protein Info for CSW01_02750 in Vibrio cholerae E7946 ATCC 55056

Annotation: DNA primase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 TIGR01391: DNA primase" amino acids 5 to 425 (421 residues), 485.3 bits, see alignment E=7.5e-150 PF01807: Zn_ribbon_DnaG" amino acids 6 to 101 (96 residues), 143.6 bits, see alignment E=4.8e-46 PF08275: DNAG_N" amino acids 133 to 257 (125 residues), 146.7 bits, see alignment E=1.4e-46 PF13662: Toprim_4" amino acids 267 to 334 (68 residues), 50.9 bits, see alignment E=5.1e-17 PF01751: Toprim" amino acids 268 to 338 (71 residues), 52.8 bits, see alignment E=1.3e-17 PF13155: Toprim_2" amino acids 270 to 356 (87 residues), 62.3 bits, see alignment E=1.7e-20 PF10410: DnaB_bind" amino acids 376 to 431 (56 residues), 34.4 bits, see alignment 7.4e-12 PF08278: DnaG_DnaB_bind" amino acids 457 to 580 (124 residues), 115.6 bits, see alignment E=6.4e-37

Best Hits

KEGG orthology group: K02316, DNA primase [EC: 2.7.7.-] (inferred from 100% identity to vco:VC0395_A0045)

Predicted SEED Role

"DNA primase (EC 2.7.7.-)" in subsystem DNA-replication or Macromolecular synthesis operon (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (587 amino acids)

>CSW01_02750 DNA primase (Vibrio cholerae E7946 ATCC 55056)
MAGHIPRSFIDDLLARLDIVDVIDARVKLKKKGKNYSACCPFHNEKTPSFSVSQEKQFYH
CFGCGAHGNAIDFVMEYERMEFPEAIEELASTIGLEVQREERTPSSPFAKNTPAVKSEDK
RSLYDLMGSIAQFYRQQLKVPANKHAIEYLKNRGLSGEIVQKFGIGYIADEWDLVRRNFG
QQRSSEDMLVTAGMLIENDNGRRYDRFRGRVMFPIRDRRGRVIGFGGRITEQGTPKYLNS
PETPIFHKGKELYGLYEVLQAYREPPQILVVEGYMDVVALAQYGVDYSVASLGTSTTGDH
LQLLFRQTNHVICCYDGDRAGRDAAWRALENALSYLKSGNILKFLFLPDGEDPDSYVRKY
GKADFEQQVANATPLSQYLFENLIELHQINLGSHEGKSALRAVATPLIDKIPDPFLQEIL
EKLLDERTGFDHQLRRKKARKTENRPAPHKAIKRTPMRDVIALLIQNPSYAELVPDLASV
RHLMIPGLDTFSEVLEKCRQYPHITTGQLLEHWRDSKNETLLSRLASWEIPLVEDNQEEL
FLDSLDKILAQCVEKQIENLQAKERSVGLSTEEKRELQDLILKGLKA