Protein Info for CSW01_02710 in Vibrio cholerae E7946 ATCC 55056

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 transmembrane" amino acids 155 to 174 (20 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details PF08448: PAS_4" amino acids 20 to 112 (93 residues), 24.3 bits, see alignment E=7.6e-09 PF00989: PAS" amino acids 20 to 111 (92 residues), 30.5 bits, see alignment E=7.8e-11 TIGR00229: PAS domain S-box protein" amino acids 20 to 115 (96 residues), 44 bits, see alignment E=1.1e-15 PF13426: PAS_9" amino acids 28 to 113 (86 residues), 36.4 bits, see alignment E=1.4e-12 PF08447: PAS_3" amino acids 35 to 118 (84 residues), 62.3 bits, see alignment E=1.1e-20 PF00015: MCPsignal" amino acids 324 to 490 (167 residues), 152.7 bits, see alignment E=2.3e-48

Best Hits

KEGG orthology group: K03776, aerotaxis receptor (inferred from 100% identity to vcj:VCD_001093)

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (529 amino acids)

>CSW01_02710 chemotaxis protein (Vibrio cholerae E7946 ATCC 55056)
MESIMRKNLPVTGHNIELSSSTNILSTTTPDSHITYVNPDFLKISGFAEEELIGQPHNMV
RHPDMPPAAFAHMWSTLKSGRSWMGLVKNRCKNGDHYWVSAFAMPIIKNGKVVEYQSVRT
KPEPSHVQAAEKAYAQLRNGKNILPKIRLGFHWKLILLVWGSLFASIAIVSLIYPSALMS
ILFLTLLVGSITTLGITYLLVPMKRLIQSYCKDSDNPLSQVLYTGRSDEFGQLEFALRMA
QAETSAVIGRIGDASNQLNKFANDLLHNIEKSNILTSEQQAETEQVATAINEMAASIQEV
ATGAKHAANSSESANHETISGQQIVSQASQSITELEHEVSQAKQVIHELEEHSNDISKVL
EVIRSIADQTNLLALNAAIEAARAGESGRGFAVVADEVRGLAARTQQSTMDIQRMIDTLQ
GRAKLAVAVMEHSSQQALLSVEQAQQAADALTGIGKRVSDITGMSVQMATAVDQQSAVSD
EINHSISNIRMAADTNVDNGKINAKCAEGVAGLSHNLSELAQQFWERNK