Protein Info for CSW01_02700 in Vibrio cholerae E7946 ATCC 55056

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 TIGR00608: DNA repair protein RadC" amino acids 24 to 157 (134 residues), 143 bits, see alignment E=5.6e-46 PF04002: RadC" amino acids 38 to 156 (119 residues), 151.6 bits, see alignment E=4.5e-49

Best Hits

Swiss-Prot: 100% identical to Y510_VIBCH: UPF0758 protein VC_0510 (VC_0510) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 100% identity to vch:VC0510)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>CSW01_02700 hypothetical protein (Vibrio cholerae E7946 ATCC 55056)
MNPKTSEYQKQQRYQENEILEHAAEILANRYVRGDALTNPDATKEYVRCKLGSYEREVFA
LLLLDNQNRLIEFKELFQGTVDAASVYPREVVKAVLEVNAAAVIFAHNHPSGDSTPSQAD
RRITERLKDTLALVDVRVLDHIVTGDTCTSFAERGWL