Protein Info for CSW01_02480 in Vibrio cholerae E7946 ATCC 55056

Annotation: Holliday junction resolvase RuvX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 PF03652: RuvX" amino acids 4 to 136 (133 residues), 131.2 bits, see alignment E=1.7e-42 TIGR00250: putative transcription antitermination factor YqgF" amino acids 6 to 136 (131 residues), 162.2 bits, see alignment E=3.1e-52

Best Hits

Swiss-Prot: 100% identical to YQGF_VIBCH: Putative pre-16S rRNA nuclease (VC_0466) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07447, putative holliday junction resolvase [EC: 3.1.-.-] (inferred from 100% identity to vcj:VCD_001140)

MetaCyc: 64% identical to ribonuclease H-like domain-containing nuclease (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-, 3.1.11.1

Use Curated BLAST to search for 3.1.-.- or 3.1.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>CSW01_02480 Holliday junction resolvase RuvX (Vibrio cholerae E7946 ATCC 55056)
MSRTVMAFDYGTKSIGSAIGQEITGTASPLKAFKANDGIPNWDEIEKQIKEWQPNLLIVG
LPTDLHGKDLDTITPRAKKFAQRLHGRFGLPVELHDERLSTTEARAELFAMGGYKALSKG
NVDCQSAVIILESWFESQWG