Protein Info for CSW01_02450 in Vibrio cholerae E7946 ATCC 55056

Annotation: pyrroline-5-carboxylate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR00112: pyrroline-5-carboxylate reductase" amino acids 6 to 268 (263 residues), 237.4 bits, see alignment E=1e-74 PF03807: F420_oxidored" amino acids 6 to 99 (94 residues), 84.1 bits, see alignment E=9e-28 PF14748: P5CR_dimer" amino acids 163 to 268 (106 residues), 106.6 bits, see alignment E=7.7e-35

Best Hits

Swiss-Prot: 73% identical to P5CR_VIBAL: Pyrroline-5-carboxylate reductase (proC) from Vibrio alginolyticus

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 100% identity to vch:VC0460)

MetaCyc: 35% identical to pyrroline-5-carboxylate reductase (Hordeum vulgare)
Pyrroline-5-carboxylate reductase. [EC: 1.5.1.2]

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>CSW01_02450 pyrroline-5-carboxylate reductase (Vibrio cholerae E7946 ATCC 55056)
MEQRSIAFIGAGNMARAIIAGLIASGYAADKIIATAPSLTRREPLEAQYGIRTTSDNLAA
AQQADVVVLAVKPQLMAEVCKPLQAVDFSGKLVISIAAGVSVKRLNEMLATQLNLVRVMP
NTPSLVNLGMSGLYAPDSVSEADKAFTTQLMQSVGEVCWVDNESGINSVIAAAGSAPAYF
FLFMQAMQQEAMAQGFDEATARLLVQQSALGAAAMVKANPELSLATLREQVTSKGGTTAQ
AIQTFNDHQLSDIVAKAMQAAVTRAQEMEQLF