Protein Info for CSW01_02445 in Vibrio cholerae E7946 ATCC 55056

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 95 to 120 (26 residues), see Phobius details amino acids 152 to 175 (24 residues), see Phobius details PF02325: CCB3_YggT" amino acids 1 to 82 (82 residues), 74 bits, see alignment E=4.9e-25 amino acids 99 to 175 (77 residues), 79 bits, see alignment E=1.3e-26

Best Hits

Swiss-Prot: 90% identical to YPI3_VIBAL: Uncharacterized protein in proC 3'region from Vibrio alginolyticus

KEGG orthology group: K02221, YggT family protein (inferred from 100% identity to vco:VC0395_A0011)

Predicted SEED Role

"Integral membrane protein YggT, involved in response to extracytoplasmic stress (osmotic shock)" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>CSW01_02445 hypothetical protein (Vibrio cholerae E7946 ATCC 55056)
MNSLSFLINTLFDLYIMVVILRIWLQAARADFYNPFSQFIVKATQPVVGPLRRVIPSIGS
IDLATIVFAYVLCVLKFMALVLIASSGSVSFSADFLFLGLLSLIKAAGGLLFWVLLIRAI
LSWVSQGRSPIEYVFHQLTEPMLAPIRRIIPVMGGFDLSVLVLFIVLQFANFLMGDVIGP
IWYQL