Protein Info for CSW01_02335 in Vibrio cholerae E7946 ATCC 55056

Annotation: chaperone SurA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13624: SurA_N_3" amino acids 25 to 141 (117 residues), 50.6 bits, see alignment E=6.1e-17 PF09312: SurA_N" amino acids 27 to 144 (118 residues), 139.7 bits, see alignment E=1.5e-44 PF13623: SurA_N_2" amino acids 30 to 111 (82 residues), 30.1 bits, see alignment E=1.3e-10 PF13616: Rotamase_3" amino acids 165 to 272 (108 residues), 80 bits, see alignment E=6.2e-26 amino acids 280 to 382 (103 residues), 82.6 bits, see alignment E=9.5e-27 PF00639: Rotamase" amino acids 180 to 271 (92 residues), 72.7 bits, see alignment E=1.3e-23 amino acids 287 to 378 (92 residues), 79.8 bits, see alignment E=7.3e-26

Best Hits

Swiss-Prot: 100% identical to SURA_VIBCH: Chaperone SurA (surA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03771, peptidyl-prolyl cis-trans isomerase SurA [EC: 5.2.1.8] (inferred from 100% identity to vco:VC0395_A2863)

Predicted SEED Role

"Survival protein SurA precursor (Peptidyl-prolyl cis-trans isomerase SurA) (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>CSW01_02335 chaperone SurA (Vibrio cholerae E7946 ATCC 55056)
MKLWKPTLISVLSALTLFNAHAEPKQLDSVAVIVNSGVILQSDVDSALKTIKANAKQNKQ
PLPQETVLREQVLEKLIIDTLQQQEADRIGVKIDDNRLNEAIKEIAKNNQQTQEQLIASV
AQEGLTYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQETDATVQYKISH
IQLRVDDGQDKSTAETLANKLVNDLRNGADFAQMAYAYSKGPKALQGGDWGWMRKEEMPT
IFADQIKMQNKGSIIGPFRSGVGFHILKIDDVKGLETVAVTEVNARHILIKPTIILSDEG
AQKQLNEFVQRIKNGEVTFAELAQQYSQDPGSAAQKGELGYQTPDLYVPEFKHQIETLPV
GQISEPFKTVHGWHIVEVLDRREVDRTDSALKNKAYRILFNRKFNEEASAWLQELRASAF
VEVLKDEKDEQ