Protein Info for CSW01_02135 in Vibrio cholerae E7946 ATCC 55056

Annotation: MSHA biogenesis protein MshE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 PF05157: MshEN" amino acids 62 to 149 (88 residues), 60.9 bits, see alignment E=9.4e-21 PF00437: T2SSE" amino acids 177 to 559 (383 residues), 434.6 bits, see alignment E=2.4e-134

Best Hits

KEGG orthology group: K12276, MSHA biogenesis protein MshE (inferred from 100% identity to vco:VC0395_A2823)

Predicted SEED Role

"MSHA biogenesis protein MshE" in subsystem Mannose-sensitive hemagglutinin type 4 pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (575 amino acids)

>CSW01_02135 MSHA biogenesis protein MshE (Vibrio cholerae E7946 ATCC 55056)
MPINKLRKRLGDLLVEEGIVSEAQLEQALNAQKNTGRRLGDTLISLGFLSETQLLNFLAQ
QLSLPVIDLSRAHVDIDAVPLLPEVHARRLRALVIGRSGDTLRIAMSDPADLFAQEALLN
QLPDYGFEFVIAPEKQLVDGFDRYYRRTKEIVSFAEQLHAEHKTNDSFDFEITDSDSDEV
TVVKLINSLFEDAIQVGASDIHIEPDANVLRLRQRIDGVLHETLLHEVNIASALVLRLKL
MANLDISEKRLPQDGRFNIRVKGQSVDIRMSTMPIQHGESVVMRLLNQSAGVRKLEESGI
PPHLLLRLRHQLKRPHGMILVTGPTGSGKTTTLYGALNELNTSGKKIITAEDPVEYRISR
INQVQVNPKINLDFSTLLRTFLRQDPDIILVGEMRDQETVEIGLRAALTGHLVLSTLHTN
DAVDSALRLIDMGAPGYLVASAVRAVVAQRLVRKVCPDCSGHDEVDEARRQWLVTRFPNQ
AAAKFTRGRGCQNCNLTGYRGRIGVFEMLELDQPMMDCLRANDAVAFSKAARSNTDYKPL
LASAMELALQGIVSLDEVMSLGEGDSSGLVEPIYL