Protein Info for CSW01_02095 in Vibrio cholerae E7946 ATCC 55056

Annotation: ssDNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00621: single-stranded DNA-binding protein
  • amino acids 3 to 177 (175 residues), 205.1 bits, E=4.6e-65
• PF00436: SSB
  • amino acids 6 to 105 (100 residues), 140.7 bits, E=8.2e-46

Best Hits

Swiss-Prot: 100% identical to SSB_VIBCH: Single-stranded DNA-binding protein (ssb) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03111, single-strand DNA-binding protein (inferred from 100% identity to vcj:VCD_001226)

MetaCyc: 74% identical to ssDNA-binding protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Protein Sequence (177 amino acids)

>CSW01_02095 ssDNA-binding protein (Vibrio cholerae E7946 ATCC 55056)
MASRGVNKVILIGNLGQDPEVRYMPSGGAVANITIATSETWRDKATGEQKEKTEWHRVTL
YGKLAEVAGEYLRKGSQVYIEGQLQTRKWQDQSGQDRYSTEVVVQGYNGIMQMLGGRAQQ
GGMPAQGGMNVPAQQGSWGQPQQPAKQHQPMQQSAPQQYSQPQYNEPPMDFDDDIPF