Protein Info for CSW01_01835 in Vibrio cholerae E7946 ATCC 55056

Annotation: RNA-binding protein Hfq

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02383: RNA chaperone Hfq
  • amino acids 5 to 64 (60 residues), 100.7 bits, E=1.5e-33
• PF17209: Hfq
  • amino acids 7 to 69 (63 residues), 104 bits, E=1.3e-34

Best Hits

Swiss-Prot: 100% identical to HFQ_VIBCH: RNA-binding protein Hfq (hfq) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03666, host factor-I protein (inferred from 100% identity to vcm:VCM66_0331)

Predicted SEED Role

"RNA-binding protein Hfq" in subsystem Hfl operon or Polyadenylation bacterial

Protein Sequence (87 amino acids)

>CSW01_01835 RNA-binding protein Hfq (Vibrio cholerae E7946 ATCC 55056)
MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS
TVVPARPVSHHSGDRPASDRPAEKSEE