Protein Info for CSW01_01810 in Vibrio cholerae E7946 ATCC 55056

Annotation: tRNA epoxyqueuosine(34) reductase QueG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 TIGR00276: epoxyqueuosine reductase" amino acids 10 to 343 (334 residues), 505.1 bits, see alignment E=4.2e-156 PF08331: QueG_DUF1730" amino acids 58 to 136 (79 residues), 86.1 bits, see alignment E=1.8e-28 PF13484: Fer4_16" amino acids 188 to 252 (65 residues), 81.7 bits, see alignment E=8.4e-27

Best Hits

Swiss-Prot: 100% identical to QUEG_VIBCH: Epoxyqueuosine reductase (queG) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to vch:VC0342)

MetaCyc: 65% identical to epoxyqueuosine reductase (Escherichia coli K-12 substr. MG1655)
RXN-12104 [EC: 1.17.99.6]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>CSW01_01810 tRNA epoxyqueuosine(34) reductase QueG (Vibrio cholerae E7946 ATCC 55056)
MDYQQLANQIKQWAIELGFEKVGICDVDLSEHEPALQAWLDAGYHGEMDWMARHGMMRAR
PAELLPGTLRVISARINYLPPQAQFASNLSDPNQAYISRYALGRDYHKLVRNQLKKLGEK
IEQEVGKLGYRPFVDSAPILERPLAQKAGLGWTGKHSLILDKENGSWFFLGELLVDIPLP
VDEPSENQCGKCTACITSCPTNAIVAEGVVDARRCVSYLTIEYSGVIPLEFRRAMGNRIY
GCDDCQLVCPWNRFAPLTQQSDFHRRQSLNNADLVVLFEWDEATFLKNMEGSAIRRIGHQ
QWRRNLIIAMGNAPYSPRIIDTLQRHLGQSELLDEHIHWALEEQTQKTATPRQHARLIRI
IEKGLPRDA