Protein Info for CSW01_01740 in Vibrio cholerae E7946 ATCC 55056

Annotation: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01676: Metalloenzyme
  • amino acids 5 to 494 (490 residues), 298.5 bits, E=6.2e-93
• TIGR01307: phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
  • amino acids 5 to 508 (504 residues), 759.7 bits, E=6e-233
• PF06415: iPGM_N
  • amino acids 83 to 297 (215 residues), 277.4 bits, E=1.2e-86
• PF01663: Phosphodiest
  • amino acids 380 to 448 (69 residues), 24.1 bits, E=4e-09

Best Hits

Swiss-Prot: 100% identical to GPMI_VIBCH: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (gpmI) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 100% identity to vcj:VCD_001288)

MetaCyc: 73% identical to 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Escherichia coli K-12 substr. MG1655)
3PGAREARR-RXN [EC: 5.4.2.12]

Predicted SEED Role

"2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of N-acetylneuraminate degradation (20/22 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (16/17 steps found)
• gluconeogenesis I (13/13 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (17/19 steps found)
• glycolysis I (from glucose 6-phosphate) (12/13 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• Rubisco shunt (9/10 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• glycolysis III (from glucose) (9/11 steps found)
• superpathway of hexitol degradation (bacteria) (14/18 steps found)
• glycolysis IV (8/10 steps found)
• photorespiration II (8/10 steps found)
• homolactic fermentation (9/12 steps found)
• Bifidobacterium shunt (11/15 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (5/9 steps found)
• glycerol degradation to butanol (10/16 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (24/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.1 or 5.4.2.12

Protein Sequence (510 amino acids)

>CSW01_01740 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Vibrio cholerae E7946 ATCC 55056)
MSAKKPMALVILDGWGYREDNANNAINNARTPVMDSLMANNPHTLISASGMDVGLPDGQM
GNSEVGHTNIGAGRIVYQDLTRITKAIMDGEFQHNKVLVAAIDKAVAAGKAVHLMGLMSP
GGVHSHEDHIYAAVEMAAARGAEKIYLHCFLDGRDTPPRSAEASLKRFQDLFAKLGKGRI
ASIVGRYYAMDRDNNWDRVEKAYDLLTLAQGEFTYDSAVEALQAAYAREENDEFVKATEI
RAAGQESAAMQDGDALLFMNYRADRARQITRTFVPDFAGFSRKAFPALDFVMLTQYAADI
PLQCAFGPASLENTYGEWLSKAGKTQLRISETEKYAHVTFFFNGGVENEFPGEERQLVAS
PKVATYDLQPEMSSKELTDKLVAAIKSGKYDAIICNYPNGDMVGHTGVYEAAVKACEAVD
ECIGRVVEAIKEVDGQLLITADHGNAEMMIDPETGGVHTAHTSLPVPLIYVGNKAISLKE
GGKLSDLAPTMLALSDLDIPADMSGQVLYS