Protein Info for CSW01_01720 in Vibrio cholerae E7946 ATCC 55056

Annotation: uroporphyrinogen decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF01208: URO-D" amino acids 9 to 352 (344 residues), 481.4 bits, see alignment E=7.8e-149 TIGR01464: uroporphyrinogen decarboxylase" amino acids 13 to 352 (340 residues), 474.4 bits, see alignment E=9.1e-147

Best Hits

Swiss-Prot: 100% identical to DCUP_VIBC3: Uroporphyrinogen decarboxylase (hemE) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K01599, uroporphyrinogen decarboxylase [EC: 4.1.1.37] (inferred from 100% identity to vcm:VCM66_0316)

MetaCyc: 84% identical to uroporphyrinogen decarboxylase (Escherichia coli K-12 substr. MG1655)
Uroporphyrinogen decarboxylase. [EC: 4.1.1.37]

Predicted SEED Role

"Uroporphyrinogen III decarboxylase (EC 4.1.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.1.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>CSW01_01720 uroporphyrinogen decarboxylase (Vibrio cholerae E7946 ATCC 55056)
MGITMTELKNDRYLRALLKQPVDYTPVWMMRQAGRYLPEYRATRAQAGDFMALCKNAELA
SEVTLQPLRRFPLDAAILFSDILTIPDAMGLGLRFAAGEGPVFERPITCKADVDKIGIPD
PEGELQYVMNAVRQIRKDLQGEVPLIGFSGSPWTLATYMVEGGSSKAFTKIKKMMYSEPT
VLHALLDKLADSVISYLNAQIKAGAQAVMVFDTWGGVLTPRDYQQFSLQYMHKIVDGLIR
ENEGRRVPVTLFTKNGGMWLEQIAATGCDAVGLDWTINIADAKARVGDKVALQGNMDPSI
LYAPAPRIREEVASILAGFGQGGTGHVFNLGHGIHLDVPPENAGVFVEAVHELSKPYHP